Loading...
Statistics
Advertisement

Tecno-lac Industrias Químicas para la Madera
www.tecnolac.es/
Tecno-Lac es una empresa de hoy, fundada para dar la mejor respuesta al sector de recubrimientos de la madera, preparada para fabricar barniz con la más ...

Tecnolac.es

Advertisement
Conversion Technology Metas Server
Tecnolac.es is hosted in Spain . Tecnolac.es doesn't use HTTPS protocol. Number of used technologies: 3. First technologies: CSS, Html, Javascript, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Microsoft-IIS/8.0.

Technologies in use by Tecnolac.es

Technology

Number of occurences: 3
  • CSS
  • Html
  • Javascript

Advertisement

Server Type

  • Microsoft-IIS/8.0

Powered by

  • ASP.NET

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Founded!
visitors Clickable email Founded!
visitors CTA (call to action) button Not founded!
visitors List Founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Tecnolac.es

Missing HTTPS protocol.

    Meta - Tecnolac.es

    Number of occurences: 3
    • Name:
      Content: text/html; charset=iso-8859-1
    • Name: keywords
      Content: Barniz Barnices, Rioja alava rioja alavesa disolventes, lacas, tecnología, calidad, pinturas La Guardia industrias quimicas madera recubrimientos producción resinas tintes colores fondos terminaciones pigmentados disolventes
    • Name: description
      Content: Tecno-Lac es una empresa de hoy, fundada para dar la mejor respuesta al sector de recubrimientos de la madera, preparada para fabricar barniz con la más avanzada técnica disponible en el mercado

    Server / Hosting

    • IP: 217.76.132.226
    • Latitude: 40.42
    • Longitude: -3.68
    • Country: Spain

    Rname

    • dns18.servidoresdns.net
    • dns17.servidoresdns.net
    • smtp-02.servidoresdns.net

    Target

    • hostmaster.servidoresdns.net

    HTTP Header Response

    HTTP/1.1 302 Found Cache-Control: private Content-Length: 156 Content-Type: text/html Location: http://www.tecnolac.es/index_es.asp Server: Microsoft-IIS/8.0 Set-Cookie: ASPSESSIONIDSSCBSAAC=PJFFCAHANGDENIMGFHLLDBKL; path=/ X-Powered-By: ASP.NET Date: Mon, 08 Aug 2016 19:50:47 GMT X-Cache: MISS from s_hh40 X-Cache-Lookup: MISS from s_hh40:80 Via: 1.1 s_hh40 (squid/3.5.11) Connection: keep-alive HTTP/1.1 200 OK Cache-Control: private Content-Length: 5471 Content-Type: text/html Server: Microsoft-IIS/8.0 Set-Cookie: ASPSESSIONIDSSCBSAAC=AKFFCAHAGKFLIGFMJMFCNAHO; path=/ X-Powered-By: ASP.NET Date: Mon, 08 Aug 2016 19:50:47 GMT X-Cache: MISS from s_hh40 X-Cache-Lookup: MISS from s_hh40:80 Via: 1.1 s_hh40 (squid/3.5.11) Connection: keep-alive

    DNS

    host: tecnolac.es
    1. class: IN
    2. ttl: 3600
    3. type: A
    4. ip: 217.76.132.226
    host: tecnolac.es
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns18.servidoresdns.net
    host: tecnolac.es
    1. class: IN
    2. ttl: 3600
    3. type: NS
    4. target: dns17.servidoresdns.net
    host: tecnolac.es
    1. class: IN
    2. ttl: 3600
    3. type: SOA
    4. mname: dns17.servidoresdns.net
    5. rname: hostmaster.servidoresdns.net
    6. serial: 2013120270
    7. refresh: 21600
    8. retry: 3600
    9. expire: 2419200
    10. minimum-ttl: 1800
    host: tecnolac.es
    1. class: IN
    2. ttl: 3600
    3. type: MX
    4. pri: 10
    5. target: smtp-02.servidoresdns.net

    Common Typos/Mistakes

    This list shows You some spelling mistakes at internet search for this domain.

    www.ecnolac.es, www.tqecnolac.es, www.qecnolac.es, www.taecnolac.es, www.aecnolac.es, www.t ecnolac.es, www. ecnolac.es, www.twecnolac.es, www.wecnolac.es, www.teecnolac.es, www.eecnolac.es, www.tzecnolac.es, www.zecnolac.es, www.txecnolac.es, www.xecnolac.es, www.tcecnolac.es, www.cecnolac.es, www.tcnolac.es, www.texcnolac.es, www.txcnolac.es, www.tescnolac.es, www.tscnolac.es, www.tewcnolac.es, www.twcnolac.es, www.tercnolac.es, www.trcnolac.es, www.tefcnolac.es, www.tfcnolac.es, www.tevcnolac.es, www.tvcnolac.es, www.teccnolac.es, www.tccnolac.es, www.teqcnolac.es, www.tqcnolac.es, www.teacnolac.es, www.tacnolac.es, www.teycnolac.es, www.tycnolac.es, www.tenolac.es, www.tecdnolac.es, www.tednolac.es, www.tecrnolac.es, www.ternolac.es, www.tectnolac.es, www.tetnolac.es, www.tecvnolac.es, www.tevnolac.es, www.tecfnolac.es, www.tefnolac.es, www.tecgnolac.es, www.tegnolac.es, www.technolac.es, www.tehnolac.es, www.tecnnolac.es, www.tennolac.es, www.tecmnolac.es, www.temnolac.es, www.tecjnolac.es, www.tejnolac.es, www.tecolac.es, www.tecnnolac.es, www.tecnolac.es, www.tecnholac.es, www.techolac.es, www.tecnjolac.es, www.tecjolac.es, www.tecnkolac.es, www.teckolac.es, www.tecnlolac.es, www.teclolac.es, www.tecn olac.es, www.tec olac.es, www.tecnlac.es, www.tecnoblac.es, www.tecnblac.es, www.tecnohlac.es, www.tecnhlac.es, www.tecnoglac.es, www.tecnglac.es, www.tecnojlac.es, www.tecnjlac.es, www.tecnomlac.es, www.tecnmlac.es, www.tecno lac.es, www.tecn lac.es, www.tecnovlac.es, www.tecnvlac.es, www.tecnoac.es, www.tecnoluac.es, www.tecnouac.es, www.tecnol8ac.es, www.tecno8ac.es, www.tecnol9ac.es, www.tecno9ac.es, www.tecnoljac.es, www.tecnojac.es, www.tecnol0ac.es, www.tecno0ac.es, www.tecnolmac.es, www.tecnomac.es, www.tecnolpac.es, www.tecnopac.es, www.tecnoloac.es, www.tecnooac.es, www.tecnolc.es, www.tecnolaoc.es, www.tecnoloc.es, www.tecnolapc.es, www.tecnolpc.es, www.tecnola9c.es, www.tecnol9c.es, www.tecnolac.es, www.tecnolc.es, www.tecnolaic.es, www.tecnolic.es, www.tecnolauc.es, www.tecnoluc.es, www.tecnola.es, www.tecnolacd.es, www.tecnolad.es, www.tecnolacr.es, www.tecnolar.es, www.tecnolact.es, www.tecnolat.es, www.tecnolacv.es, www.tecnolav.es, www.tecnolacf.es, www.tecnolaf.es, www.tecnolacg.es, www.tecnolag.es, www.tecnolach.es, www.tecnolah.es, www.tecnolacn.es, www.tecnolan.es, www.tecnolacm.es, www.tecnolam.es, www.tecnolacj.es, www.tecnolaj.es,

    Other websites we recently analyzed

    1. kentong.ca
      Jacksonville (United States) - 206.188.193.238
      Server software: Apache
      Technology: CSS, Html, Javascript, jQuery Cycle, Php
      Number of Javascript: 5
      Number of meta tags: 1
    2. Acceuil Michael.W.Savard
      Houston (United States) - 192.185.92.223
      Server software: nginx/1.10.1
      Technology: Html
      Number of meta tags: 5
    3. naturaldogdeli.com
      United Kingdom - 81.21.76.62
      Server software: Apache/2.2.3 (CentOS)
      Technology: CSS, Html, Javascript, Php
      Number of Javascript: 1
      Number of meta tags: 1
    4. Home Page
      Dublin (Ireland) - 46.51.204.184
      Server software: nginx
      Technology: CloudFront, CSS, Google Font API, Html
      Number of Javascript: 5
      Number of meta tags: 5
    5. 9¸æž°è¡¾æ»ž
      Ottawa (Canada) - 47.90.10.47
      Server software: Apache
      Technology: CSS, Html, Iframe, Javascript, jQuery, Php
      Number of Javascript: 15
      Number of meta tags: 3
    6. drawwritenow.com
      Lansing (United States) - 67.225.133.85
      Server software: Apache
      Technology: Html
      Number of meta tags: 1
    7. İzmirdeki Tüm Mekan ve Dükkanlar - İzmir Evreni
      İzmirin Sanal Reklam Ağı İzmirdeki Tüm Dükkan ve Mekanların Reklamlarını Yayınlıyoruz.imagedummyipsumprintingindustrytextsimplypictureloremtypesettingreklamcafehediyelikhergdaapartfastfoodeyizantaindustryzmrdekindustrysiteindustrypreviousnextsampleamacimizeyaevrenielektrikelektronikbistrodkkancopyrightbacklinkayakkabclasspreviewenerjiakaryaktemlakaperatifevrenievrenevrenireklamreklamletmzmrdekszlemesiyasaltamaclkspotsitemapreklamlarnsayfazmrtantmtarihizccaciyezmiryurtwaffletekstilvizyonumuzpetotomamllerimarketzmirevrenicomdesignletiimkincikiralamamekanlarizmirdekimekanlarreklamreklamizmirzmrizmirnaatnakliyemimarlkmhendislikmekanlarzmirinjiyansimply dummydummy textprinting typesettinglorem ipsumtext printingipsum simplyheresample imageimage describedescribe imageindustry loremtypesetting industryimage heresamplehediyelik kozmetikhal ayakkabeyiz alverieya aydnlatmagaziemir sitemapgiyim naatelektronik mobilyaara kiralamaaperatif sporanta otomotivaksesuar nakliyeasanal reklambujiteri fastfoodelence tekstilclasspreview zmircafelerpreviousnextsample pictureevren amacimizindustrysite mapteknoloji elektriktantm yazlartamaclk mobilturizmtatil hertypesetting industrypreviousnextsampleyurt biliimykama zccaciyewaffle eitimkrtasiyeshop backlinksemtleriizmir tarihilanlari letmzmrdekjiyan kinogizlilikzmir evrenizmirzmirevrenizmirletiim gzellikbakmpastaneunlu mamllerireklamlarn yaynlyoruzsamplereklam zmirdekipicture loremimage herepreviousnextsampleimage heresample imageipsum simply dummyprinting typesetting industrydummy text printingsimply dummy textindustry lorem ipsumtypesetting industry loremindustrypreviousnextsample picture lorembistro pastaneunlu mamllerijiyan kinogizlilik szlemesiyasalcafe gaziemir sitemapimage herepreviousnextsample pictureclasspreview zmir evrenienerjiakaryakt turizmtatil hermekanlarzmirin sanal reklamtamaclk mobil ototantm yazlar pettypesetting industrypreviousnextsample picturewaffle eitimkrtasiye gdareklamlarn yaynlyoruzsample imageprinting typesetting industryzmrdekmekanlarreklamreklamizmirzmrizmir semtleriizmir tarihizmir evrenizmirzmirevrenizmir evrenievrenevrenireklamreklampicture lorem ipsumprinting typesetting industrysiteletiim gzellikbakm emlak
      Germany - 146.0.42.37
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Html, Iframe, Javascript, jQuery Cycle, jQuery Fancybox, Php, SuperFish
      Number of Javascript: 16
      Number of meta tags: 10
    8. Danny's Pizza | A Great Restaurant in Douglas, Georgia
      Scottsdale (United States) - 184.168.165.1
      Server software: Microsoft-IIS/7.5
      Technology: CSS, Google Font API, Html, Html5, Javascript, jQuery, Php, Pingback, Shortcodes, SVG, WordPress Stats, Wordpress
      Number of Javascript: 14
      Number of meta tags: 4
    9. Agence Phiphi PLUS - Agence de Communication PHIPHI+
      Provo (United States) - 50.87.163.120
      G Analytics ID: UA-80660667-1
      Server software: Apache
      Technology: CSS, Html, Html5, Javascript, jQuery, jQuery UI, Php, Google Analytics, Joomla
      Number of Javascript: 14
      Number of meta tags: 3
    10. Welkom bij Toyota dealer Autobedrijf Alex van de Velde Zuidzande B.V.
      Dit is de officiële Toyota dealerwebsite van Autobedrijf Alex van de Velde Zuidzande B.V. met o.a. de (hybride) Toyota modellen, Occasions, Acties en Nieuws..
      Netherlands - 193.239.132.218
      Server software: Microsoft-IIS/8.5
      Technology: Carousel, CSS, Html, Html5, Javascript, Google Analytics
      Number of Javascript: 7
      Number of meta tags: 6

    Check Other Websites